Structure of PDB 8xt0 Chain L8 |
>8xt0L8 (length=128) Species: 9606 (Homo sapiens) [Search protein sequence] |
YRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGS LWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAEC MAKMPQMIVNWQQQQRENWEKAQADKER |
|
PDB | 8xt0 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline. |
Chain | L8 |
Resolution | 3.2 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
L8 |
W50 K59 |
W26 K35 |
|
|
|
|