Structure of PDB 5wlc Chain L8

Receptor sequence

>5wlcL8 (length=170) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]

GISRDSRHKRSATGAKRAQFRKKRKFELGRQPANTKIGAKRIHSVRTRGG
NKKYRALRIETGNFSWASEGISKKTRIAGVVYHPSNNELVRTNTLTKAAI
VQIDATPFRQWFEAHYGQTLGKAKIESSVESQFSAGRLYACISSRPGQSG
RCDGYILEGEELAFYLRRLT

3D structure

PDB

5wlc The complete structure of the small-subunit processome.

Chain

Resolution

3.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L8	R5 H9 K10 R11 T14 R18 F21 K23 R25 K26 F27 L29 G30 R31 I43 R47 T48 R49 G50 N52 K54 R56 N64 S66 I72 S73 K75 S86 T97 K98 S170 R172 G174 Q175 R178 D180	R4 H8 K9 R10 T13 R17 F20 K22 R24 K25 F26 L28 G29 R30 I42 R46 T47 R48 G49 N51 K53 R55 N63 S65 I71 S72 K74 S85 T96 K97 S143 R145 G147 Q148 R151 D153

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5wlc, PDBe:5wlc, PDBj:5wlc
PDBsum	5wlc
PubMed	28945246
UniProt	P0CX39\|RS8A_YEAST Small ribosomal subunit protein eS8A (Gene Name=RPS8A)

[Back to BioLiP]