Structure of PDB 8hl4 Chain L7A1

Receptor sequence
>8hl4L7A1 (length=123) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
PSYVKFEVPQELADKVLEAVKKAKDSGKIKKGTNETTKAVERSQAKLVVI
AEDVQPEEIVAHLPLLCEEKKIPYVYVPSKKSLGEACGLQVAAASVALMD
PGEAKDLVDEIVKRVNEIKGKSS
3D structure
PDB8hl4 Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
ChainL7A1
Resolution4.62 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L7A1 K34 G35 T36 N37 E38 K41 R45 V57 Q58 L92 Q93 A96 A97 K31 G32 T33 N34 E35 K38 R42 V54 Q55 L89 Q90 A93 A94
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0019843 rRNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hl4, PDBe:8hl4, PDBj:8hl4
PDBsum8hl4
PubMed37604686
UniProtQ4J8P1|RL7A_SULAC Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]