Structure of PDB 7y7a Chain L7

Receptor sequence
>7y7aL7 (length=140) Species: 35688 (Porphyridium purpureum) [Search protein sequence]
DFISPYNEDPFVGNLSTPINTSSFTKGLLSNLPAYRRGLSPLLRGLEIGM
AHGYFLIGPFYKLGPLRSTDVALLSGFLSTVGLILILTTCLSIYGSVSFD
KEDTKDSLQTSEGWGQFTAGFLVGAVGGSGFAYLLLANLP
3D structure
PDB7y7a In situ structure of the red algal phycobilisome-PSII-PSI-LHC megacomplex.
ChainL7
Resolution4.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZEX L7 L76 V125 L74 V123
BS02 CLA L7 P61 F62 L65 G66 P67 P59 F60 L63 G64 P65
BS03 CLA L7 L58 L89 L56 L87
BS04 CLA L7 P67 L80 S81 G84 I88 P65 L78 S79 G82 I86
BS05 CLA L7 N16 T19 I21 N22 L31 N14 T17 I19 N20 L29
BS06 CLA L7 N33 L34 R38 E49 N31 L32 R36 E47
BS07 CLA L7 P35 A36 I50 P33 A34 I48
BS08 CLA L7 Y56 F57 G60 P61 L138 Y54 F55 G58 P59 L136
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009538 photosystem I reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7y7a, PDBe:7y7a, PDBj:7y7a
PDBsum7y7a
PubMed36922595
UniProtW0S1Z0

[Back to BioLiP]