Structure of PDB 3j6x Chain L7

Receptor sequence

>3j6xL7 (length=222) Species: 580240 (Saccharomyces cerevisiae W303)

AEQVAAERAARKAANKEKRAIILERNAAYQKEYETAERNIIQAKRDAKAA
GSYYVEAQHKLVFVVRIKGINKIPPKPRKVLQLLRLTRINSGTFVKVTKA
TLELLKLIEPYVAYGYPSYSTIRQLVYKRGFGKINKQRVPLSDNAIIEAN
LGKYGILSIDDLIHEIITVGPHFKQANNFLWPFKLSNPSGGWGVPRKFKH
FIQGGSFGNREEFINKLVKSMN

3D structure

• PDB: 3j6x Taura syndrome virus IRES initiates translation by binding its tRNA-mRNA-like structural element in the ribosomal decoding center.
• Chain: L7
• Resolution: 6.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L7	R30 K34 R67 G91 K94 I95 P97 K98 K101 L105 R110 I111 N112 E125 L126 R145 K158 Q159 R160 K196 L207 S208 N209 P210 S211 W214 K219 F220 K241	R8 K12 R45 G69 K72 I73 P75 K76 K79 L83 R88 I89 N90 E103 L104 R123 K136 Q137 R138 K174 L185 S186 N187 P188 S189 W192 K197 F198 K219
BS02	rna	L7	K128 E131 H222 I224 Q225	K106 E109 H200 I202 Q203

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000470 maturation of LSU-rRNA
• GO:0002181 cytoplasmic translation
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j6x, PDBe:3j6x, PDBj:3j6x
• PDBsum: 3j6x
• PubMed: 24927574
• UniProt: P05737|RL7A_YEAST Large ribosomal subunit protein uL30A (Gene Name=RPL7A)