Structure of PDB 8rdw Chain L6

Receptor sequence

>8rdwL6 (length=122) Species: 45610 (Psychrobacter urativorans) [Search protein sequence]

ATTNQLIRKGRKTIKEKSKVPALQACPQRRGVCTRVYTTTPKKPNSAMRK
VCRVRLTSGYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGA
LDCAGVKDRKQGRSKYGAKKPK

3D structure

PDB

8rdw A new family of bacterial ribosome hibernation factors

Chain

Resolution

2.74 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L6	A2 N5 Q6 L7 R9 R12 T14 K18 V21 A26 C27 P28 Q29 R30 R31 K44 N46 S47 A48 M49 R50 K51 T58 Y66 G68 G69 E70 R83 G84 K88 D89 R94 R110 K111 Q112 R114 S115 K116 G118 A119 K120 K121	A1 N4 Q5 L6 R8 R11 T13 K17 V20 A25 C26 P27 Q28 R29 R30 K43 N45 S46 A47 M48 R49 K50 T57 Y65 G67 G68 E69 R82 G83 K87 D88 R93 R109 K110 Q111 R113 S114 K115 G117 A118 K119 K120

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

External links