Structure of PDB 8rd8 Chain L6

Receptor sequence

>8rd8L6 (length=122) Species: 45610 (Psychrobacter urativorans) [Search protein sequence]

ATTNQLIRKGRKTIKEKSKVPALQACPQRRGVCTRVYTTTPKKPNSAMRK
VCRVRLTSGYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGA
LDCAGVKDRKQGRSKYGAKKPK

3D structure

PDB

8rd8 A new family of bacterial ribosome hibernation factors

Chain

Resolution

2.62 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L6	A2 N5 Q6 L7 R9 K10 R12 K13 T14 K18 A26 C27 P28 Q29 R30 R31 K43 K44 N46 S47 A48 M49 R50 K51 T58 Y66 G68 G69 E70 R83 G84 R86 K88 D89 R110 K111 Q112 R114 S115 K116 G118 A119 K120 K121	A1 N4 Q5 L6 R8 K9 R11 K12 T13 K17 A25 C26 P27 Q28 R29 R30 K42 K43 N45 S46 A47 M48 R49 K50 T57 Y65 G67 G68 E69 R82 G83 R85 K87 D88 R109 K110 Q111 R113 S114 K115 G117 A118 K119 K120

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

External links