Structure of PDB 8k2b Chain L6

Receptor sequence
>8k2bL6 (length=94) Species: 9606 (Homo sapiens) [Search protein sequence]
RGRIPGRQWIGKHRRPRFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQ
ERGHAAVRRREAFEAIKAAATSKFPPHRFIADQLDHLNVTKKWS
3D structure
PDB8k2b Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
ChainL6
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L6 R9 R11 I12 P13 G14 R15 Q16 W17 G19 K20 H21 R23 R25 F26 S28 R30 A31 N34 R56 R60 A63 R66 R67 F71 I74 K75 A78 K81 R86 H94 K100 R1 R3 I4 P5 G6 R7 Q8 W9 G11 K12 H13 R15 R17 F18 S20 R22 A23 N26 R48 R52 A55 R58 R59 F63 I66 K67 A70 K73 R78 H86 K92
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8k2b, PDBe:8k2b, PDBj:8k2b
PDBsum8k2b
PubMed38942792
UniProtQ9BQC6|RT63_HUMAN Large ribosomal subunit protein mL63 (Gene Name=MRPL57)

[Back to BioLiP]