Structure of PDB 5zf0 Chain L6

Receptor sequence

>5zf0L6 (length=151) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]

LVKPYNGDPFVGHLSTPISDSGLVKTFIGNLPAYRQGLSPILRGLEVGMA
HGYFLIGPWVKLGPLRDSDVANLGGLISGIALILVATACLAAYGLVSFQK
GGSSSDPLKTSEGWSQFTAGFFVGAMGSAFVAFFLLENFLVVDGIMTGLF
N

3D structure

PDB

5zf0 X-ray structure of an asymmetrical trimeric ferredoxin-photosystem I complex

Chain

Resolution

4.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	L6	Y56 L138 I148	Y53 L135 I145
BS02	CA	L6	F153 N154	F150 N151
BS03	CLA	L6	P61 W62 L65 G66 P67 R69	P58 W59 L62 G63 P64 R66
BS04	CLA	L6	W62 P67 I80 S81	W59 P64 I77 S78
BS05	CLA	L6	V88 C92	V85 C89
BS06	CLA	L6	H16 T19 I21 S22	H13 T16 I18 S19
BS07	CLA	L6	F57 L58 L85 A89	F54 L55 L82 A86
BS08	CA	L6	P67 D70	P64 D67
BS09	CLA	L6	R38 E49 M52	R35 E46 M49
BS10	CLA	L6	P35 E49 V50 A53 H54	P32 E46 V47 A50 H51
BS11	CLA	L6	Y56 F57 K64 L138 F142	Y53 F54 K61 L135 F139
BS12	CLA	L6	A91 A94	A88 A91

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009522	photosystem I
GO:0009538	photosystem I reaction center
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5zf0, PDBe:5zf0, PDBj:5zf0
PDBsum	5zf0
PubMed	29610537
UniProt	Q8DGB4\|PSAL_THEVB Photosystem I reaction center subunit XI (Gene Name=psaL)

[Back to BioLiP]