Structure of PDB 5tcu Chain L6

Receptor sequence
>5tcuL6 (length=89) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
EARDILKRPVITEKSSEAMAEDKYTFDVDTRVNKTQVKMAVEEIFNVKVA
SVNIMNYKPKKKRMGRYQGYTNKRRKAIVTLKEGSIDLF
3D structure
PDB5tcu Structural Basis for Linezolid Binding Site Rearrangement in the Staphylococcus aureus Ribosome.
ChainL6
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L6 K15 K24 N34 K35 Q37 K39 N54 I55 N57 K59 Y68 G70 N73 R76 K77 I79 K14 K23 N33 K34 Q36 K38 N53 I54 N56 K58 Y67 G69 N72 R75 K76 I78
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5tcu, PDBe:5tcu, PDBj:5tcu
PDBsum5tcu
PubMed28487427
UniProtQ2FW08|RL23_STAA8 Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]