Structure of PDB 4u50 Chain L6

Receptor sequence

>4u50L6 (length=156) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

SAQKAPKWYPSEDVAALKKTRKAARPQKLRASLVPGTVLILLAGRFRGKR
VVYLKHLEDNTLLISGPFKVNGVPLRRVNARYVIATSTKVSVEGVNVEKF
NVEYFAKEEIKAERVEDQKVVDKALIAEIKKTPLLKQYLSASFSLKNGDK
PHMLKF

3D structure

PDB

4u50 ?

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L6	S2 A3 K5 K8 W9 Y10 S12 A17 L18 K19 K20 T21 R22 K23 A24 R26 Q28 G45 R46 F47 R48 N61 T62 F69 K70 V71 N72 G73 P75 R77 R78 N80 R82 Y83 E129 I130 Q157 S162 N167	S1 A2 K4 K7 W8 Y9 S11 A16 L17 K18 K19 T20 R21 K22 A23 R25 Q27 G44 R45 F46 R47 N60 T61 F68 K69 V70 N71 G72 P74 R76 R77 N79 R81 Y82 E109 I110 Q137 S142 N147

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4u50, PDBe:4u50, PDBj:4u50
PDBsum	4u50
PubMed	25209664
UniProt	Q02326\|RL6A_YEAST Large ribosomal subunit protein eL6A (Gene Name=RPL6A)

[Back to BioLiP]