Structure of PDB 3j77 Chain L6

Receptor sequence

>3j77L6 (length=156) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

SAQKAPKWYPSEDVAALKKTRKAARPQKLRASLVPGTVLILLAGRFRGKR
VVYLKHLEDNTLLISGPFKVNGVPLRRVNARYVIATSTKVSVEGVNVEKF
NVEYFAKEEIKAERVEDQKVVDKALIAEIKKTPLLKQYLSASFSLKNGDK
PHMLKF

3D structure

PDB

3j77 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.

Chain

Resolution

6.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L6	S2 A3 K8 W9 A16 A17 L18 K19 T21 R22 K23 A24 R26 Q28 G45 R46 F47 T62 F69 K70 N72 G73 P75 R77 R78 Y83 K108 E129 I130 R134 V135 Q157 S160 A161 S162 K166 N167 K170	S1 A2 K7 W8 A15 A16 L17 K18 T20 R21 K22 A23 R25 Q27 G44 R45 F46 T61 F68 K69 N71 G72 P74 R76 R77 Y82 K107 E109 I110 R114 V115 Q137 S140 A141 S142 K146 N147 K150

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3j77, PDBe:3j77, PDBj:3j77
PDBsum	3j77
PubMed	25043550
UniProt	Q02326\|RL6A_YEAST Large ribosomal subunit protein eL6A (Gene Name=RPL6A)

[Back to BioLiP]