Structure of PDB 3j6x Chain L6

Receptor sequence
>3j6xL6 (length=156) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence]
SAQKAPKWYPSEDVAALKKTRKAARPQKLRASLVPGTVLILLAGRFRGKR
VVYLKHLEDNTLLISGPFKVNGVPLRRVNARYVIATSTKVSVEGVNVEKF
NVEYFAKEEIKAERVEDQKVVDKALIAEIKKTPLLKQYLSASFSLKNGDK
PHMLKF
3D structure
PDB3j6x Taura syndrome virus IRES initiates translation by binding its tRNA-mRNA-like structural element in the ribosomal decoding center.
ChainL6
Resolution6.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L6 S2 K8 Y10 A16 A17 L18 K19 T21 R22 K23 R26 Q28 G45 R46 T62 F69 K70 N72 R77 R78 N80 R82 K108 E129 I130 S162 K166 N167 S1 K7 Y9 A15 A16 L17 K18 T20 R21 K22 R25 Q27 G44 R45 T61 F68 K69 N71 R76 R77 N79 R81 K107 E109 I110 S142 K146 N147
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j6x, PDBe:3j6x, PDBj:3j6x
PDBsum3j6x
PubMed24927574
UniProtQ02326|RL6A_YEAST Large ribosomal subunit protein eL6A (Gene Name=RPL6A)

[Back to BioLiP]