Structure of PDB 7azo Chain L5A

Receptor sequence

>7azoL5A (length=181) Species: 300852 (Thermus thermophilus HB8)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 7azo Discovery of natural-product-derived sequanamycins as potent oral anti-tuberculosis agents.
• Chain: L5A
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L5A	S76 S78 R83	S75 S77 R82
BS02	rna	L5A	K36 V38 N40 G42 G44 E45 T71 A73 K74 I77 N79 F80 L82 I88 S124 D126 R128 N132 L133 G134 L135 R153 G154 M155 D156	K35 V37 N39 G41 G43 E44 T70 A72 K73 I76 N78 F79 L81 I87 S123 D125 R127 N131 L132 G133 L134 R152 G153 M154 D155
BS03	rna	L5A	P2 N27 V28 W29 E30 Q66 K67 P68 A69 V70 T71 R91 V92 T93 R95 R96	P1 N26 V27 W28 E29 Q65 K66 P67 A68 V69 T70 R90 V91 T92 R94 R95
BS04	MG	L5A	N123 F125	N122 F124

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7azo, PDBe:7azo, PDBj:7azo
• PDBsum: 7azo
• PubMed: 36827973
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)