Structure of PDB 7qep Chain L5

Receptor sequence

>7qepL5 (length=283) Species: 284813 (Encephalitozoon cuniculi GB-M1)

SNAKGTRNYHKNFQVKRRRRREGKTDYKHRTNMIRQDSNSCGSVKHRLVV
RITGSRVICQIVAAYMDGDRVMVYADSRELERYGINFGATNYSAAYATGF
LIGRRALTAMSLDEVYRPKEIDGTYSVTKDIDGEKKAPRVFLDIGLARST
RGARVFGALKGASDAGLNVPHSAAKFYGHKPDGSFDAKELHDRIFGYNIS
EYMKQLRDGDPEKYKTQFSSYIKKGIDPEEIPRIYKSAFDKIAEDPTRKK
KETKDYSGFKKYKQARLTYEERAKRVQAKLSAA

3D structure

• PDB: 7qep Adaptation to genome decay in the structure of the smallest eukaryotic ribosome
• Chain: L5
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L5	S2 K5 N9 N13 F14 Q15 K17 R21 N33 K46 F142 H172 S173 K176	S1 K4 N8 N12 F13 Q14 K16 R20 N32 K45 F141 H171 S172 K175
BS02	rna	L5	K5 H11 K12 V16 R18 R19 R20 R22 R31 R48 G55 R57 Q61 G69 D70 V72 Y75 N92 Y93 R149 T151 R152 A154 R155 N199 I200 Y203 Q218 S220 S221 Y222 R249 Y257 F260 K261 Y263 K264 Q265 R267 R276 V277	K4 H10 K11 V15 R17 R18 R19 R21 R30 R47 G54 R56 Q60 G68 D69 V71 Y74 N91 Y92 R148 T150 R151 A153 R154 N198 I199 Y202 Q217 S219 S220 Y221 R248 Y256 F259 K260 Y262 K263 Q264 R266 R275 V276

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7qep, PDBe:7qep, PDBj:7qep
• PDBsum: 7qep
• UniProt: Q8SRQ3