Structure of PDB 5m1j Chain L5

Receptor sequence

>5m1jL5 (length=193) Species: 4932 (Saccharomyces cerevisiae)

AISKNLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARATRAAKIAPRPL
DLLRPVVRAPTVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRR
QNRNQEIFDANVQRLKEYQSKIIVFPRNGKAPEAEQVLSAAATFPIAQPA
TDVEARAVQDNGESAFRTLRLARSEKKFRGIREKRAREKAEAE

3D structure

• PDB: 5m1j Structural insights into ribosomal rescue by Dom34 and Hbs1 at near-atomic resolution.
• Chain: L5
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L5	A2 S4 K5 L7 L10 K11 N12 H13 F14 R15 K16 H17 W18 Q19 F26 Q28 A29 K31 K32 R35 R36 R39 R42 R55 V58 R59 P61 T62 V63 Y65 K68 R70 G72 R73 K81 T86 R91 D98 H99 R100 R101 R104 N105 R128 K131 F167 R171 R174 S175 F179 G181 R183 R186	A1 S3 K4 L6 L9 K10 N11 H12 F13 R14 K15 H16 W17 Q18 F25 Q27 A28 K30 K31 R34 R35 R38 R41 R54 V57 R58 P60 T61 V62 Y64 K67 R69 G71 R72 K80 T85 R90 D97 H98 R99 R100 R103 N104 R127 K130 F166 R170 R173 S174 F178 G180 R182 R185
BS02	rna	L5	D27 K31 S34	D26 K30 S33
BS03	MG	L5	H17 R21	H16 R20

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5m1j, PDBe:5m1j, PDBj:5m1j
• PDBsum: 5m1j
• PubMed: 27995908
• UniProt: Q12690|RL13A_YEAST Large ribosomal subunit protein eL13A (Gene Name=RPL13A)