Structure of PDB 5dc3 Chain L5

Receptor sequence

>5dc3L5 (length=296) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

AFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRL
VVRFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYAT
GLLIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQ
RTTTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFG
GHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADP
AFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ

3D structure

PDB

5dc3 Crystal Structure of Hypusine-Containing Translation Factor eIF5A Bound to a Rotated Eukaryotic Ribosome.

Chain

Resolution

3.25 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L5	K5 D6 K8 Y12 R15 F16 Q17 P19 R23 T28 Y31 Q32 R35 L36 K43 Y44 K48 R140 P141 F142 K143 F145 L146 I148 R152 T153 P174 H175 S176 N178 R179	K4 D5 K7 Y11 R14 F15 Q16 P18 R22 T27 Y30 Q31 R34 L35 K42 Y43 K47 R139 P140 F141 K142 F144 L145 I147 R151 T152 P173 H174 S175 N177 R178
BS02	rna	L5	K8 S10 S13 S14 T18 F20 R21 R22 R24 K27 T28 Y30 R33 R50 R54 T56 N57 K58 I61 Q63 I69 T70 G71 D72 V74 Y79 G91 N94 W95 R152 T154 T155 A157 R158 Y198 H203 V204 Y207 E210 R218 L222 K224 Y226 T256 F260 Q264 Y265 A266 E268 S269 Y272 Q274 T275 K276 L277 K279 R285 V286	K7 S9 S12 S13 T17 F19 R20 R21 R23 K26 T27 Y29 R32 R49 R53 T55 N56 K57 I60 Q62 I68 T69 G70 D71 V73 Y78 G90 N93 W94 R151 T153 T154 A156 R157 Y197 H202 V203 Y206 E209 R217 L221 K223 Y225 T255 F259 Q263 Y264 A265 E267 S268 Y271 Q273 T274 K275 L276 K278 R284 V285

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5dc3, PDBe:5dc3, PDBj:5dc3
PDBsum	5dc3
PubMed	27196944
UniProt	P26321\|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]