Structure of PDB 3j77 Chain L5

Receptor sequence

>3j77L5 (length=296) Species: 4932 (Saccharomyces cerevisiae)

AFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRL
VVRFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYAT
GLLIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQ
RTTTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFG
GHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADP
AFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ

3D structure

• PDB: 3j77 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.
• Chain: L5
• Resolution: 6.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L5	R15 F16 Q17 P19 R23 T28 Y31 Q32 R35 L36 Y44 L113 L115 R140 P141 F142 F145 L146 R152 T153 F160 P174 R179	R14 F15 Q16 P18 R22 T27 Y30 Q31 R34 L35 Y43 L112 L114 R139 P140 F141 F144 L145 R151 T152 F159 P173 R178
BS02	rna	L5	S13 F16 F20 R21 R22 R24 T28 R33 R54 T56 N57 K58 D59 T70 D72 V74 G91 N94 R152 T154 T155 G156 A157 R158 Y198 H203 Q206 Y207 E221 Y226 T256 K258 K262 Q264 Y265 A266 E268 S269 Q274 K276 R282	S12 F15 F19 R20 R21 R23 T27 R32 R53 T55 N56 K57 D58 T69 D71 V73 G90 N93 R151 T153 T154 G155 A156 R157 Y197 H202 Q205 Y206 E220 Y225 T255 K257 K261 Q263 Y264 A265 E267 S268 Q273 K275 R281

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j77, PDBe:3j77, PDBj:3j77
• PDBsum: 3j77
• PubMed: 25043550
• UniProt: P26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)