Structure of PDB 8hkz Chain L44E

Receptor sequence

>8hkzL44E (length=92) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

MKVPKVIKTYCPKCKTHTEHSVSLYKGGKRRSLAEGQRRYERKNVGYGSK
RKPEQKRFAKTTKKQTLVLKCQKCSYTIVKEGMRLKKLELVE

3D structure

PDB

8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.

Chain

L44E

Resolution

4.78 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L44E	M1 K2 I7 K8 T9 Y10 K15 T16 H17 Y25 G27 G28 K29 R30 R31 L33 E35 G36 R38 R39 R42 K43 Y47 G48 S49 K50 P53 E54 K56 R57 A59 K60 K63 K64 Y76 T77 E81 M83 R84 L85 K86	M1 K2 I7 K8 T9 Y10 K15 T16 H17 Y25 G27 G28 K29 R30 R31 L33 E35 G36 R38 R39 R42 K43 Y47 G48 S49 K50 P53 E54 K56 R57 A59 K60 K63 K64 Y76 T77 E81 M83 R84 L85 K86
BS02	rna	L44E	K52 E54 Q55	K52 E54 Q55

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding
GO:0019843	rRNA binding
GO:0046872	metal ion binding
GO:0070180	large ribosomal subunit rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links