Structure of PDB 8hku Chain L44E

Receptor sequence

>8hkuL44E (length=92) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

MKVPKVIKTYCPKCKTHTEHSVSLYKGGKRRSLAEGQRRYERKNVGYGSK
RKPEQKRFAKTTKKQTLVLKCQKCSYTIVKEGMRLKKLELVE

3D structure

PDB

8hku Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome

Chain

L44E

Resolution

2.72 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L44E	M1 K2 P4 K8 Y10 H17 Y25 K29 R30 R31 L33 A34 E35 G36 R38 R39 R42 K43 G46 Y47 S49 K50 K52 P53 E54 Q55 A59 K60 K64 T66 T77 K80 E81 L85 K86	M1 K2 P4 K8 Y10 H17 Y25 K29 R30 R31 L33 A34 E35 G36 R38 R39 R42 K43 G46 Y47 S49 K50 K52 P53 E54 Q55 A59 K60 K64 T66 T77 K80 E81 L85 K86
BS02	rna	L44E	Y40 K52 P53	Y40 K52 P53

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding
GO:0019843	rRNA binding
GO:0046872	metal ion binding
GO:0070180	large ribosomal subunit rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links