Structure of PDB 8k2a Chain L4

Receptor sequence
>8k2aL4 (length=83) Species: 9606 (Homo sapiens) [Search protein sequence]
LKDPDVCTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPK
TLEELDPESREYWRRLRKQNIWRHNRLSKNKRL
3D structure
PDB8k2a Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
ChainL4
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L4 R115 R119 R120 R122 K123 I126 H129 N130 S133 K134 R60 R64 R65 R67 K68 I71 H74 N75 S78 K79
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8k2a, PDBe:8k2a, PDBj:8k2a
PDBsum8k2a
PubMed38942792
UniProtQ6P161|RM54_HUMAN Large ribosomal subunit protein mL54 (Gene Name=MRPL54)

[Back to BioLiP]