Structure of PDB 6gzz Chain L4

Receptor sequence
>6gzzL4 (length=125) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRK
VAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGV
YDAAGVKDRKKSRSKYGTKKPKEAA
3D structure
PDB6gzz Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.
ChainL4
Resolution4.13 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L4 P5 N8 Q9 R15 E16 G29 P31 R34 K46 K47 L52 R53 Y69 G72 E73 R89 V90 K91 D92 R97 G103 K115 R117 S118 Y120 K123 P1 N4 Q5 R11 E12 G25 P27 R30 K42 K43 L48 R49 Y65 G68 E69 R85 V86 K87 D88 R93 G99 K111 R113 S114 Y116 K119
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gzz, PDBe:6gzz, PDBj:6gzz
PDBsum6gzz
PubMed30301898
UniProtQ5SHN3|RS12_THET8 Small ribosomal subunit protein uS12 (Gene Name=rpsL)

[Back to BioLiP]