Structure of PDB 8hkz Chain L39E

Receptor sequence
>8hkzL39E (length=49) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
KHKSLGKKLRLGKALKRNSPIPAWVIIKTQAEIRFNPLRRNWRRNNLKV
3D structure
PDB8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.
ChainL39E
Resolution4.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L39E K3 H4 K5 L7 K10 L11 R12 G14 K15 R19 P24 W26 I29 K30 T31 Q32 A33 I35 R36 P39 R41 R42 W44 R45 R46 N47 N48 V51 K1 H2 K3 L5 K8 L9 R10 G12 K13 R17 P22 W24 I27 K28 T29 Q30 A31 I33 R34 P37 R39 R40 W42 R43 R44 N45 N46 V49
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hkz, PDBe:8hkz, PDBj:8hkz
PDBsum8hkz
PubMed37604686
UniProtP13005|RL39_SULAC Large ribosomal subunit protein eL39 (Gene Name=rpl39e)

[Back to BioLiP]