Structure of PDB 8hku Chain L39E

Receptor sequence
>8hkuL39E (length=49) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
KHKSLGKKLRLGKALKRNSPIPAWVIIKTQAEIRFNPLRRNWRRNNLKV
3D structure
PDB8hku Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
ChainL39E
Resolution2.72 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L39E K3 H4 K5 L7 K10 L11 R12 L13 G14 K15 A16 S21 P22 I23 P24 W26 V27 K30 T31 Q32 E34 F37 P39 R42 W44 R45 L49 K1 H2 K3 L5 K8 L9 R10 L11 G12 K13 A14 S19 P20 I21 P22 W24 V25 K28 T29 Q30 E32 F35 P37 R40 W42 R43 L47
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hku, PDBe:8hku, PDBj:8hku
PDBsum8hku
PubMed37604686
UniProtP13005|RL39_SULAC Large ribosomal subunit protein eL39 (Gene Name=rpl39e)

[Back to BioLiP]