Structure of PDB 8hl5 Chain L37E

Receptor sequence

>8hl5L37E (length=54) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

MKGTPSFGKMNKTPTHVRCRRCGRNSFNARKGYCAACGFGRSKKIRRYSW
QNKK

3D structure

PDB

8hl5 Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome

Chain

L37E

Resolution

5.72 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L37E	M1 K2 G3 T4 S6 F7 G8 K9 M10 N11 K12 T13 P14 T15 H16 R18 C19 R20 R21 R24 N25 S26 N28 R30 K31 Y33 A35 F39 R41 S42 K43 K44 I45 R47 Y48 S49 W50 K53 K54	M1 K2 G3 T4 S6 F7 G8 K9 M10 N11 K12 T13 P14 T15 H16 R18 C19 R20 R21 R24 N25 S26 N28 R30 K31 Y33 A35 F39 R41 S42 K43 K44 I45 R47 Y48 S49 W50 K53 K54

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

External links

PDB	RCSB:8hl5, PDBe:8hl5, PDBj:8hl5
PDBsum	8hl5
PubMed	37604686
UniProt	Q4JAZ9\|RL37_SULAC Large ribosomal subunit protein eL37 (Gene Name=rpl37e)