Structure of PDB 8hkz Chain L37E

Receptor sequence
>8hkzL37E (length=54) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
MKGTPSFGKMNKTPTHVRCRRCGRNSFNARKGYCAACGFGRSKKIRRYSW
QNKK
3D structure
PDB8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.
ChainL37E
Resolution4.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L37E M1 K2 G3 T4 P5 F7 G8 K9 M10 N11 K12 T13 P14 T15 H16 R20 R21 A29 R30 Y33 R41 S42 K43 K44 I45 R46 R47 Y48 S49 W50 K53 K54 M1 K2 G3 T4 P5 F7 G8 K9 M10 N11 K12 T13 P14 T15 H16 R20 R21 A29 R30 Y33 R41 S42 K43 K44 I45 R46 R47 Y48 S49 W50 K53 K54
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hkz, PDBe:8hkz, PDBj:8hkz
PDBsum8hkz
PubMed37604686
UniProtQ4JAZ9|RL37_SULAC Large ribosomal subunit protein eL37 (Gene Name=rpl37e)

[Back to BioLiP]