Structure of PDB 8hl2 Chain L34E

Receptor sequence

>8hl2L34E (length=77) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

SPQQRSGSFRKVFVKLPSGKSTIHYERRKDNIARCGMCKKPLNGVKNNYT
YKYSKTEKRPERVYGGYLCHKCLESLI

3D structure

PDB

8hl2 Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome

Chain

L34E

Resolution

4.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L34E	S3 Q5 R7 S8 R12 K13 F15 V16 K17 L18 P19 S20 G21 K22 R30 K31 I34 A35 R36 C37 G38 M39 P43 N45 Y55 K57 T58 E59 K60 R61 E63 R64 V65 Y66 Y69	S1 Q3 R5 S6 R10 K11 F13 V14 K15 L16 P17 S18 G19 K20 R28 K29 I32 A33 R34 C35 G36 M37 P41 N43 Y53 K55 T56 E57 K58 R59 E61 R62 V63 Y64 Y67

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

External links

PDB	RCSB:8hl2, PDBe:8hl2, PDBj:8hl2
PDBsum	8hl2
PubMed	37604686
UniProt	O05981\|RL34_SULAC Large ribosomal subunit protein eL34 (Gene Name=rpl34e)