Structure of PDB 8hky Chain L34E

Receptor sequence

>8hkyL34E (length=77) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

SPQQRSGSFRKVFVKLPSGKSTIHYERRKDNIARCGMCKKPLNGVKNNYT
YKYSKTEKRPERVYGGYLCHKCLESLI

3D structure

PDB

8hky Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome

Chain

L34E

Resolution

4.45 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L34E	S3 Q6 R7 S8 S10 R12 F15 V16 K17 L18 P19 S20 G21 K22 D32 N33 I34 A35 R36 C37 G38 M39 P43 N45 G46 K48 Y55 S56 K57 T58 E59 R61 E63 R64 Y66 G68 Y69	S1 Q4 R5 S6 S8 R10 F13 V14 K15 L16 P17 S18 G19 K20 D30 N31 I32 A33 R34 C35 G36 M37 P41 N43 G44 K46 Y53 S54 K55 T56 E57 R59 E61 R62 Y64 G66 Y67

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

External links

PDB	RCSB:8hky, PDBe:8hky, PDBj:8hky
PDBsum	8hky
PubMed	37604686
UniProt	O05981\|RL34_SULAC Large ribosomal subunit protein eL34 (Gene Name=rpl34e)