Structure of PDB 8hkz Chain L32E

Receptor sequence

>8hkzL32E (length=123) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

KPAKKNMKSPGKAIKFLRFDWDKYYRIGRQERWRKPRGIDNAIRLELKGY
QPKVKIGYRTDKQIRGLHPSGLRPILVKSVKDLEAFAKGKQDVIIIISST
IGLRKRIELIKKAEELGLKIANR

3D structure

PDB

8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.

Chain

L32E

Resolution

4.78 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L32E	P4 K14 I16 R20 F21 D22 K25 Y26 Y27 R28 I29 R31 R34 W35 R36 K37 G40 I41 D42 N43 E48 K50 Y52 Q53 K57 I58 G59 Y60 R61 T62 D63 K64 Q65 R67 L69 P71 S72 S81 S100 S101 T102 I103 G104 L105 K107 R125	P2 K12 I14 R18 F19 D20 K23 Y24 Y25 R26 I27 R29 R32 W33 R34 K35 G38 I39 D40 N41 E46 K48 Y50 Q51 K55 I56 G57 Y58 R59 T60 D61 K62 Q63 R65 L67 P69 S70 S79 S98 S99 T100 I101 G102 L103 K105 R123

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8hkz, PDBe:8hkz, PDBj:8hkz
PDBsum	8hkz
PubMed	37604686
UniProt	O05638\|RL32_SULAC Large ribosomal subunit protein eL32 (Gene Name=rpl32e)