Structure of PDB 8hku Chain L32E

Receptor sequence

>8hkuL32E (length=123) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

KPAKKNMKSPGKAIKFLRFDWDKYYRIGRQERWRKPRGIDNAIRLELKGY
QPKVKIGYRTDKQIRGLHPSGLRPILVKSVKDLEAFAKGKQDVIIIISST
IGLRKRIELIKKAEELGLKIANR

3D structure

PDB

8hku Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome

Chain

L32E

Resolution

2.72 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L32E	F18 R20 F21 D24 K25 Y26 Y27 R28 I29 R31 R34 W35 R36 K37 R39 G40 I41 D42 E48 K50 Y52 V56 K57 I58 G59 R61 T62 D63 K64 R67 G68 H70 P71 S81 K83 S100 S101 T102 G104 L105 R106 K107 N124	F16 R18 F19 D22 K23 Y24 Y25 R26 I27 R29 R32 W33 R34 K35 R37 G38 I39 D40 E46 K48 Y50 V54 K55 I56 G57 R59 T60 D61 K62 R65 G66 H68 P69 S79 K81 S98 S99 T100 G102 L103 R104 K105 N122

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8hku, PDBe:8hku, PDBj:8hku
PDBsum	8hku
PubMed	37604686
UniProt	O05638\|RL32_SULAC Large ribosomal subunit protein eL32 (Gene Name=rpl32e)