Structure of PDB 8hkz Chain L31E

Receptor sequence
>8hkzL31E (length=75) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
KPEKENFEMVINFRRVIMGRKTTRTKRAIKYVRYMVKRHFGAEKVIIDPL
LAKAITMNGRDKIVRRVRIAVKRIG
3D structure
PDB8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.
ChainL31E
Resolution4.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L31E V51 N53 R55 M59 G60 R61 K62 K67 R68 I70 K71 Y72 R74 R79 H80 I88 M98 N99 G100 R101 R106 R107 V10 N12 R14 M18 G19 R20 K21 K26 R27 I29 K30 Y31 R33 R38 H39 I47 M57 N58 G59 R60 R65 R66
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hkz, PDBe:8hkz, PDBj:8hkz
PDBsum8hkz
PubMed37604686
UniProtP38618|RL31_SULAC Large ribosomal subunit protein eL31 (Gene Name=rpl31e)

[Back to BioLiP]