Structure of PDB 8hku Chain L31E

Receptor sequence
>8hkuL31E (length=75) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
KPEKENFEMVINFRRVIMGRKTTRTKRAIKYVRYMVKRHFGAEKVIIDPL
LAKAITMNGRDKIVRRVRIAVKRIG
3D structure
PDB8hku Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
ChainL31E
Resolution2.72 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L31E R55 R56 M59 G60 R61 K62 R65 R68 I70 K71 R74 Y75 R79 H80 I88 P90 N99 R101 R106 R107 R14 R15 M18 G19 R20 K21 R24 R27 I29 K30 R33 Y34 R38 H39 I47 P49 N58 R60 R65 R66
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hku, PDBe:8hku, PDBj:8hku
PDBsum8hku
PubMed37604686
UniProtP38618|RL31_SULAC Large ribosomal subunit protein eL31 (Gene Name=rpl31e)

[Back to BioLiP]