Structure of PDB 8hku Chain L30P

Receptor sequence

>8hkuL30P (length=155) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

MNELIGVIRIRGWAATPWYIQDTLSMLRLKNAFNAMIYPKDSSIQGMLNL
VSSYVTWGELNDEGLRLLVSKLEISRGKKVNEEYVKDKLNVDFQSFVESI
KDGKLRLNKLDEIFSLPIRLHPPKGGFKGKVSRPFRAGGEFGYRGDKINE
LIRRM

3D structure

PDB

8hku Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome

Chain

L30P

Resolution

2.72 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L30P	G12 W13 A14 A15 P17 W18 Y19 D22 T23 M26 R28 A32 Y38 S42 S43 G46 M47 E83 Y84 R119 L120 H121 P122 K124 G125 G126 F127 K128 K130 S132 R133 P134 F135	G12 W13 A14 A15 P17 W18 Y19 D22 T23 M26 R28 A32 Y38 S42 S43 G46 M47 E83 Y84 R119 L120 H121 P122 K124 G125 G126 F127 K128 K130 S132 R133 P134 F135
BS02	rna	L30P	R133 F135 R136	R133 F135 R136

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8hku, PDBe:8hku, PDBj:8hku
PDBsum	8hku
PubMed	37604686
UniProt	O05642\|RL30_SULAC Large ribosomal subunit protein uL30 (Gene Name=rpl30)

[Back to BioLiP]