Structure of PDB 8hkz Chain L30E

Receptor sequence
>8hkzL30E (length=94) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
FEGELKTLLRSGKVILGTRKTLKLLKTGKVKGVVVSSTLRQDLKDDIMTF
SKFSDIPIYLYKGSGYELGTLCGKPFMVSVIGIVDEGESKILEF
3D structure
PDB8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.
ChainL30E
Resolution4.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L30E G21 T22 R23 K24 R44 K78 F80 M81 S83 G17 T18 R19 K20 R40 K74 F76 M77 S79
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hkz, PDBe:8hkz, PDBj:8hkz
PDBsum8hkz
PubMed37604686
UniProtP11522|RL30E_SULAC Large ribosomal subunit protein eL30 (Gene Name=rpl30e)

[Back to BioLiP]