Structure of PDB 6gzz Chain L3

Receptor sequence

>6gzzL3 (length=125) Species: 300852 (Thermus thermophilus HB8)

PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRK
VAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGV
YDAAGVKDRKKSRSKYGTKKPKEAA

3D structure

• PDB: 6gzz Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.
• Chain: L3
• Resolution: 4.13 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L3	P5 N8 Q9 R12 R15 E16 K21 G29 A30 P31 R33 K47 N49 L52 Y69 G72 E73 V90 K91 D92 R97 V104 K114 K115 R117 S118 Y120 G121 K123 K124 K126	P1 N4 Q5 R8 R11 E12 K17 G25 A26 P27 R29 K43 N45 L48 Y65 G68 E69 V86 K87 D88 R93 V100 K110 K111 R113 S114 Y116 G117 K119 K120 K122

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6gzz, PDBe:6gzz, PDBj:6gzz
• PDBsum: 6gzz
• PubMed: 30301898
• UniProt: Q5SHN3|RS12_THET8 Small ribosomal subunit protein uS12 (Gene Name=rpsL)