Structure of PDB 3j77 Chain L3

Receptor sequence

>3j77L3 (length=386) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKA
GMTTIVRDLDRPGSKFHKREVVEAVTVVDTPPVVVVGVVGYVETPRGLRS
LTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARI
KKYASVVRVLVHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEK
TVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRKTHRGLRKVAC
IGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRT
KKTITPMGGFVHYGEIKNDFIMVKGCIPGNRKRIVTLRKSLYTNTSRKAL
EEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL

3D structure

PDB

3j77 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.

Chain

Resolution

6.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L3	S2 H3 R4 K5 Y6 E7 A8 P9 R10 H11 G12 H13 G15 F16 L17 P18 R19 K20 R21 I25 R26 R28 K30 A31 M53 T54 T55 R62 A75 Y92 T95 P96 R97 L99 R100 S101 L102 T104 W106 F118 Y119 K120 N121 Y123 K124 K126 K128 A129 F130 T131 K132 K153 Y154 Q173 K175 K222 G223 F226 E227 H231 W233 K236 K237 R240 K241 T242 H243 R244 L246 R247 K248 A250 C251 I252 G253 A254 W255 H256 P257 A258 H259 V260 W262 S263 R266 S274 R275 I278 N279 M308 G309 V312 H313 G315 I328 P329 G330 R332 Y343 R348 S363 K364 F365 K367 K376 M380 L383 K384	S1 H2 R3 K4 Y5 E6 A7 P8 R9 H10 G11 H12 G14 F15 L16 P17 R18 K19 R20 I24 R25 R27 K29 A30 M52 T53 T54 R61 A74 Y91 T94 P95 R96 L98 R99 S100 L101 T103 W105 F117 Y118 K119 N120 Y122 K123 K125 K127 A128 F129 T130 K131 K152 Y153 Q172 K174 K221 G222 F225 E226 H230 W232 K235 K236 R239 K240 T241 H242 R243 L245 R246 K247 A249 C250 I251 G252 A253 W254 H255 P256 A257 H258 V259 W261 S262 R265 S273 R274 I277 N278 M307 G308 V311 H312 G314 I327 P328 G329 R331 Y342 R347 S362 K363 F364 K366 K375 M379 L382 K383

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0006414	translational elongation
GO:1990145	maintenance of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3j77, PDBe:3j77, PDBj:3j77
PDBsum	3j77
PubMed	25043550
UniProt	P14126\|RL3_YEAST Large ribosomal subunit protein uL3 (Gene Name=RPL3)

[Back to BioLiP]