Structure of PDB 8hkz Chain L23P

Receptor sequence
>8hkzL23P (length=81) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
IIKEFLATEKAVKLIESQNTLTIIVNRNTTKKDIKNEVEKLFSVKVEKIN
TLITPKGEKKAYVKLKQEYKASDVAHKLGML
3D structure
PDB8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.
ChainL23P
Resolution4.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L23P T9 E10 K11 T30 K32 K49 N51 T52 L53 I54 P56 K57 Y63 T8 E9 K10 T29 K31 K48 N50 T51 L52 I53 P55 K56 Y62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hkz, PDBe:8hkz, PDBj:8hkz
PDBsum8hkz
PubMed37604686
UniProtQ4JB42|RL23_SULAC Large ribosomal subunit protein uL23 (Gene Name=rpl23)

[Back to BioLiP]