Structure of PDB 7azs Chain L23A

Receptor sequence

>7azsL23A (length=95) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MKTAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVK
VVKVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEGL

3D structure

PDB

7azs Discovery of natural-product-derived sequanamycins as potent oral anti-tuberculosis agents.

Chain

L23A

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L23A	M1 K2 S14 E15 K16 K25 H31 T35 K36 T37 E38 K40 N41 E44 K50 K53 N55 T56 L57 H58 R60 K62 K64 R65 L66 Y69 L70 G71 K72 R73 P74 D75	M1 K2 S14 E15 K16 K25 H31 T35 K36 T37 E38 K40 N41 E44 K50 K53 N55 T56 L57 H58 R60 K62 K64 R65 L66 Y69 L70 G71 K72 R73 P74 D75
BS02	MG	L23A	K53 V54 N55	K53 V54 N55

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7azs, PDBe:7azs, PDBj:7azs
PDBsum	7azs
PubMed	36827973
UniProt	Q5SHP0\|RL23_THET8 Large ribosomal subunit protein uL23 (Gene Name=rplW)