Structure of PDB 8hl4 Chain L22P

Receptor sequence

>8hl4L22P (length=150) Species: 330779 (Sulfolobus acidocaldarius DSM 639)

YPILSIPEDKLAKAVIKNIDASVRDLYNVCKAIRGMNLKEAREFLNNVLE
EKEALPFWRYSHGTSHRSNISRKWKVKSGRYPKKAIKYVLKLLDNAENNA
NSKGLDIDNLKIVHIAAHKGLVLKRYMTRAFGRSTRKYKYLSHIEVILGE

3D structure

• PDB: 8hl4 Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
• Chain: L22P
• Resolution: 4.62 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L22P	P7 V20 S27 R29 K36 W63 R64 Y65 H67 G68 T69 S70 H71 R72 S73 N74 R77 W79 K80 K82 R85 Y86 P87 K89 N100 N103 N104 K124 R130 M132 T133 R134 A135 F136 G137 R138 T140 R141 K142 Y143 K144	P2 V15 S22 R24 K31 W58 R59 Y60 H62 G63 T64 S65 H66 R67 S68 N69 R72 W74 K75 K77 R80 Y81 P82 K84 N95 N98 N99 K119 R125 M127 T128 R129 A130 F131 G132 R133 T135 R136 K137 Y138 K139

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8hl4, PDBe:8hl4, PDBj:8hl4
• PDBsum: 8hl4
• PubMed: 37604686
• UniProt: Q4JB45|RL22_SULAC Large ribosomal subunit protein uL22 (Gene Name=rpl22)