Structure of PDB 8hkz Chain L22P

Receptor sequence

>8hkzL22P (length=150) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

YPILSIPEDKLAKAVIKNIDASVRDLYNVCKAIRGMNLKEAREFLNNVLE
EKEALPFWRYSHGTSHRSNISRKWKVKSGRYPKKAIKYVLKLLDNAENNA
NSKGLDIDNLKIVHIAAHKGLVLKRYMTRAFGRSTRKYKYLSHIEVILGE

3D structure

PDB

8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.

Chain

L22P

Resolution

4.78 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L22P	K18 A19 V20 K22 R29 Y32 K36 R39 R64 Y65 H67 G68 T69 S70 H71 S73 W79 K80 K82 R85 Y86 P87 K89 K96 N100 N103 N104 H119 H123 K124 L126 R130 T133 R134 A135 F136 G137 R138 S139 T140 R141 K144	K13 A14 V15 K17 R24 Y27 K31 R34 R59 Y60 H62 G63 T64 S65 H66 S68 W74 K75 K77 R80 Y81 P82 K84 K91 N95 N98 N99 H114 H118 K119 L121 R125 T128 R129 A130 F131 G132 R133 S134 T135 R136 K139

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8hkz, PDBe:8hkz, PDBj:8hkz
PDBsum	8hkz
PubMed	37604686
UniProt	Q4JB45\|RL22_SULAC Large ribosomal subunit protein uL22 (Gene Name=rpl22)

[Back to BioLiP]