Structure of PDB 8hkv Chain L22P

Receptor sequence

>8hkvL22P (length=150) Species: 330779 (Sulfolobus acidocaldarius DSM 639)

YPILSIPEDKLAKAVIKNIDASVRDLYNVCKAIRGMNLKEAREFLNNVLE
EKEALPFWRYSHGTSHRSNISRKWKVKSGRYPKKAIKYVLKLLDNAENNA
NSKGLDIDNLKIVHIAAHKGLVLKRYMTRAFGRSTRKYKYLSHIEVILGE

3D structure

• PDB: 8hkv Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
• Chain: L22P
• Resolution: 4.94 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L22P	K18 A19 V20 K22 N23 D25 S27 R29 R64 Y65 S66 H67 G68 H71 R72 S73 R77 W79 K80 K82 R85 Y86 K88 K89 K96 N100 N103 N104 H119 A122 H123 K124 G125 R130 R134 A135 F136 G137 R138 R141 K144	K13 A14 V15 K17 N18 D20 S22 R24 R59 Y60 S61 H62 G63 H66 R67 S68 R72 W74 K75 K77 R80 Y81 K83 K84 K91 N95 N98 N99 H114 A117 H118 K119 G120 R125 R129 A130 F131 G132 R133 R136 K139

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8hkv, PDBe:8hkv, PDBj:8hkv
• PDBsum: 8hkv
• PubMed: 37604686
• UniProt: Q4JB45|RL22_SULAC Large ribosomal subunit protein uL22 (Gene Name=rpl22)