Structure of PDB 8hku Chain L22P

Receptor sequence

>8hkuL22P (length=150) Species: 330779 (Sulfolobus acidocaldarius DSM 639)

YPILSIPEDKLAKAVIKNIDASVRDLYNVCKAIRGMNLKEAREFLNNVLE
EKEALPFWRYSHGTSHRSNISRKWKVKSGRYPKKAIKYVLKLLDNAENNA
NSKGLDIDNLKIVHIAAHKGLVLKRYMTRAFGRSTRKYKYLSHIEVILGE

3D structure

• PDB: 8hku Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
• Chain: L22P
• Resolution: 2.72 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L22P	Y6 V20 R29 Y32 K36 W63 R64 Y65 H67 G68 S70 H71 R72 S73 R77 K78 W79 K80 K82 R85 Y86 K89 N100 N103 N104 A122 H123 K124 G125 R130 T133 R134 A135 F136 G137 R138 T140 R141 Y143 K144 H148	Y1 V15 R24 Y27 K31 W58 R59 Y60 H62 G63 S65 H66 R67 S68 R72 K73 W74 K75 K77 R80 Y81 K84 N95 N98 N99 A117 H118 K119 G120 R125 T128 R129 A130 F131 G132 R133 T135 R136 Y138 K139 H143

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8hku, PDBe:8hku, PDBj:8hku
• PDBsum: 8hku
• PubMed: 37604686
• UniProt: Q4JB45|RL22_SULAC Large ribosomal subunit protein uL22 (Gene Name=rpl22)