Structure of PDB 8hl2 Chain L21E

Receptor sequence
>8hl2L21E (length=97) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
VARSKGYRSKTRKLLEKKVREKGAIPKLSLLMHDYSQGEYVVVKINPSIH
KGMPHRRYHGKVGLVVGKRGKAYEVKVNIGDKERVLIVRPEHLIPFN
3D structure
PDB8hl2 Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
ChainL21E
Resolution4.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L21E V2 R4 S5 G7 R9 S10 K11 R13 K14 E17 K18 K45 K52 R57 R58 Y59 H60 K62 V63 R70 G71 K72 K83 R85 V86 I88 F97 N98 V1 R3 S4 G6 R8 S9 K10 R12 K13 E16 K17 K44 K51 R56 R57 Y58 H59 K61 V62 R69 G70 K71 K82 R84 V85 I87 F96 N97
BS02 rna L21E R21 K28 S30 R20 K27 S29
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hl2, PDBe:8hl2, PDBj:8hl2
PDBsum8hl2
PubMed37604686
UniProtQ4JB11|RL21_SULAC Large ribosomal subunit protein eL21 (Gene Name=rpl21e)

[Back to BioLiP]