Structure of PDB 8hku Chain L21E

Receptor sequence

>8hkuL21E (length=97) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

VARSKGYRSKTRKLLEKKVREKGAIPKLSLLMHDYSQGEYVVVKINPSIH
KGMPHRRYHGKVGLVVGKRGKAYEVKVNIGDKERVLIVRPEHLIPFN

3D structure

PDB

8hku Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome

Chain

L21E

Resolution

2.72 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L21E	V2 S5 K6 G7 Y8 R9 S10 K11 R13 K14 L16 E17 K18 K23 G24 S49 H51 G53 R57 R58 Y59 H60 V63 R70 K72 D82 K83 R85 V86 F97 N98	V1 S4 K5 G6 Y7 R8 S9 K10 R12 K13 L15 E16 K17 K22 G23 S48 H50 G52 R56 R57 Y58 H59 V62 R69 K71 D81 K82 R84 V85 F96 N97
BS02	rna	L21E	R21 S30	R20 S29

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8hku, PDBe:8hku, PDBj:8hku
PDBsum	8hku
PubMed	37604686
UniProt	Q4JB11\|RL21_SULAC Large ribosomal subunit protein eL21 (Gene Name=rpl21e)