Structure of PDB 7fix Chain L2

Receptor sequence

>7fixL2 (length=152) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]

ELVKPYNGDPFVGHLSTPISDSGLVKTFIGNLPAYRQGLSPILRGLEVGM
AHGYFLIGPWVKLGPLRDSDVANLGGLISGIALILVATACLAAYGLVSFQ
KGGSSSDPLKTSEGWSQFTAGFFVGAMGSAFVAFFLLENFSVVDGIMTGL
FN

3D structure

PDB

7fix Structure of cyanobacterial photosystem I complexed with ferredoxin at 1.97 angstrom resolution.

Chain

Resolution

1.97 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	L2	T90 A91 A94	T88 A89 A92
BS02	CLA	L2	V5 P20	V3 P18
BS03	CLA	L2	H16 I21 S22	H14 I19 S20
BS04	CLA	L2	P61 W62 L65 P67	P59 W60 L63 P65
BS05	CLA	L2	L85 Y96	L83 Y94
BS06	CLA	L2	W62 P67 S81	W60 P65 S79
BS07	CA	L2	P67 D70	P65 D68
BS08	CLA	L2	N33 R38 E49 M52 A53	N31 R36 E47 M50 A51
BS09	CLA	L2	I21 F30 P35 A36 V50 H54 F57	I19 F28 P33 A34 V48 H52 F55
BS10	CLA	L2	Y56 F57 G60 P61 K64 L138 L139 F142	Y54 F55 G58 P59 K62 L136 L137 F140

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009522	photosystem I
GO:0009538	photosystem I reaction center
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7fix, PDBe:7fix, PDBj:7fix
PDBsum	7fix
PubMed	36097054
UniProt	Q8DGB4\|PSAL_THEVB Photosystem I reaction center subunit XI (Gene Name=psaL)

[Back to BioLiP]