Structure of PDB 6zvk Chain L2

Receptor sequence
>6zvkL2 (length=102) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
GRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGH
MVSDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINK
ML
3D structure
PDB6zvk The Halastavi arva Virus Intergenic Region IRES Promotes Translation by the Simplest Possible Initiation Mechanism.
ChainL2
Resolution3.49 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L2 R3 R4 A6 R7 R10 K13 N14 K15 P16 F22 K39 S61 E63 A67 R90 H92 F94 R98 R2 R3 A5 R6 R9 K12 N13 K14 P15 F21 K38 S60 E62 A66 R89 H91 F93 R97
BS02 rna L2 Y11 E56 Y57 Y10 E55 Y56
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zvk, PDBe:6zvk, PDBj:6zvk
PDBsum6zvk
PubMed33296660
UniProtB7NZQ2|RL10_RABIT Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]