Structure of PDB 6gzq Chain L2

Receptor sequence
>6gzqL2 (length=125) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRK
VAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGV
YDAAGVKDRKKSRSKYGTKKPKEAA
3D structure
PDB6gzq Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.
ChainL2
Resolution3.28 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna L2 N8 Q9 R15 E16 A30 P31 F32 R33 R34 N49 S50 R53 K54 P71 G72 E73 R86 K91 D92 R113 K114 S116 R117 S118 K119 K123 K124 K126 N4 Q5 R11 E12 A26 P27 F28 R29 R30 N45 S46 R49 K50 P67 G68 E69 R82 K87 D88 R109 K110 S112 R113 S114 K115 K119 K120 K122
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gzq, PDBe:6gzq, PDBj:6gzq
PDBsum6gzq
PubMed30301898
UniProtQ5SHN3|RS12_THET8 Small ribosomal subunit protein uS12 (Gene Name=rpsL)

[Back to BioLiP]