Structure of PDB 5zf0 Chain L2

Receptor sequence

>5zf0L2 (length=151) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]

LVKPYNGDPFVGHLSTPISDSGLVKTFIGNLPAYRQGLSPILRGLEVGMA
HGYFLIGPWVKLGPLRDSDVANLGGLISGIALILVATACLAAYGLVSFQK
GGSSSDPLKTSEGWSQFTAGFFVGAMGSAFVAFFLLENFLVVDGIMTGLF
N

3D structure

PDB

5zf0 X-ray structure of an asymmetrical trimeric ferredoxin-photosystem I complex

Chain

Resolution

4.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	L2	Y56 L138 I148	Y53 L135 I145
BS02	CA	L2	F153 N154	F150 N151
BS03	CLA	L2	I21 S22	I18 S19
BS04	CLA	L2	L58 L85 A89	L55 L82 A86
BS05	CLA	L2	W62 P67 I80 S81	W59 P64 I77 S78
BS06	CLA	L2	P61 W62 L65 G66 P67	P58 W59 L62 G63 P64
BS07	CA	L2	P67 D70	P64 D67
BS08	CLA	L2	R38 E49 M52	R35 E46 M49
BS09	CLA	L2	L34 P35 A36 V50 H54	L31 P32 A33 V47 H51
BS10	CLA	L2	Y56 F57 G60 L138 F142	Y53 F54 G57 L135 F139
BS11	CLA	L2	T90 A91 A94	T87 A88 A91

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009522	photosystem I
GO:0009538	photosystem I reaction center
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5zf0, PDBe:5zf0, PDBj:5zf0
PDBsum	5zf0
PubMed	29610537
UniProt	Q8DGB4\|PSAL_THEVB Photosystem I reaction center subunit XI (Gene Name=psaL)

[Back to BioLiP]