Structure of PDB 8hl2 Chain L18P

Receptor sequence

>8hl2L18P (length=193) Species: 330779 (Sulfolobus acidocaldarius DSM 639)

TQGPNYRIKFRRRREGKTDYYTRYTYVINNAIRFVPRLTNKYVIVSVSKF
DQKGDIMIAYAHSIELVKKYGWKGDTNNTPAAYLTGYLAGLRAVKSGVKA
AVSDIGLFVPVKGGRIFAVIKGAIDAGLKVPVGDLGKLKDRVNGSHISAY
AQKLKNENQELYNKLFSSYIQRGLDPVLLPQHFEEVLNKIKEN

3D structure

• PDB: 8hl2 Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
• Chain: L18P
• Resolution: 4.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L18P	P5 N6 Y7 K10 R14 G17 T19 D20 Y22 Y27 N30 I106 P111 F118 G134	P4 N5 Y6 K9 R13 G16 T18 D19 Y21 Y26 N29 I105 P110 F117 G133
BS02	rna	L18P	T2 G4 P5 I9 F11 R12 R13 K18 T19 R24 R34 R38 T40 N41 K42 Y43 K54 G55 D56 M58 Y61 H63 I65 E66 K69 D76 N79 T80 V110 V112 K113 G114 R116 R142 Y151 Y163 N164 K165 L166 F167 Y170	T1 G3 P4 I8 F10 R11 R12 K17 T18 R23 R33 R37 T39 N40 K41 Y42 K53 G54 D55 M57 Y60 H62 I64 E65 K68 D75 N78 T79 V109 V111 K112 G113 R115 R141 Y150 Y162 N163 K164 L165 F166 Y169

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8hl2, PDBe:8hl2, PDBj:8hl2
• PDBsum: 8hl2
• PubMed: 37604686
• UniProt: O05640|RL18_SULAC Large ribosomal subunit protein uL18 (Gene Name=rpl18)