Structure of PDB 8hkz Chain L18P

Receptor sequence

>8hkzL18P (length=193) Species: 330779 (Sulfolobus acidocaldarius DSM 639)

TQGPNYRIKFRRRREGKTDYYTRYTYVINNAIRFVPRLTNKYVIVSVSKF
DQKGDIMIAYAHSIELVKKYGWKGDTNNTPAAYLTGYLAGLRAVKSGVKA
AVSDIGLFVPVKGGRIFAVIKGAIDAGLKVPVGDLGKLKDRVNGSHISAY
AQKLKNENQELYNKLFSSYIQRGLDPVLLPQHFEEVLNKIKEN

3D structure

• PDB: 8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.
• Chain: L18P
• Resolution: 4.78 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L18P	Q3 P5 N6 Y7 R8 R14 G17 Y22 T26 Y27 N30 S104 P111 F118 G134 L136	Q2 P4 N5 Y6 R7 R13 G16 Y21 T25 Y26 N29 S103 P110 F117 G133 L135
BS02	rna	L18P	T2 G4 P5 Y7 I9 F11 R12 R13 R15 K18 T19 Y21 R24 R34 R38 N41 Y43 Q53 K54 G55 D56 I57 M58 Y61 H63 I65 D76 N79 T80 G115 R116 R142 H147 Y151 Y163 N164 K165 L166 F167	T1 G3 P4 Y6 I8 F10 R11 R12 R14 K17 T18 Y20 R23 R33 R37 N40 Y42 Q52 K53 G54 D55 I56 M57 Y60 H62 I64 D75 N78 T79 G114 R115 R141 H146 Y150 Y162 N163 K164 L165 F166

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8hkz, PDBe:8hkz, PDBj:8hkz
• PDBsum: 8hkz
• PubMed: 37604686
• UniProt: O05640|RL18_SULAC Large ribosomal subunit protein uL18 (Gene Name=rpl18)